General Information

  • ID:  hor004153
  • Uniprot ID:  Q8CIT0
  • Protein name:  Corticoliberin
  • Gene name:  CRH
  • Organism:  Mus musculus (Mouse)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  Animal
  • Expression:  Up-regulated during water-avoidance stress. |Expressed in parvocellular paraventricular nucleus of the hypothalamus and in medial accessory olivary nucleus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0017045 corticotropin-releasing hormone activity; GO:0051430 corticotropin-releasing hormone receptor 1 binding; GO:0051431 corticotropin-releasing hormone receptor 2 binding
  • GO BP:  GO:0001934 positive regulation of protein phosphorylation; GO:0001963 synaptic transmission, dopaminergic; GO:0003085 negative regulation of systemic arterial blood pressure; GO:0006704 glucocorticoid biosynthetic process; GO:0006954 inflammatory response; GO:0007565 female pregnancy; GO:0007611 learning or memory; GO:0008202 steroid metabolic process; GO:0008284 positive regulation of cell population proliferation; GO:0008306 associative learning; GO:0008628 hormone-mediated apoptotic signaling pathway; GO:0009410 response to xenobiotic stimulus; GO:0010628 positive regulation of gene expression; GO:0010629 negative regulation of gene expression; GO:0010700 negative regulation of norepinephrine secretion; GO:0014062 regulation of serotonin secretion; GO:0016101 diterpenoid metabolic process; GO:0021854 hypothalamus development; GO:0030324 lung development; GO:0030325 adrenal gland development; GO:0032811 negative regulation of epinephrine secretion; GO:0033685 negative regulation of luteinizing hormone secretion; GO:0035641 locomotory exploration behavior; GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus; GO:0035902 response to immobilization stress; GO:0042220 response to cocaine; GO:0043627 response to estrogen; GO:0043950 positive regulation of cAMP-mediated signaling; GO:0045471 response to ethanol; GO:0045472 response to ether; GO:0048265 response to pain; GO:0050801 monoatomic ion homeostasis; GO:0051402 neuron apoptotic process; GO:0051412 response to corticosterone; GO:0051461 positive regulation of corticotropin secretion; GO:0051464 positive regulation of cortisol secretion; GO:0060291 long-term synaptic potentiation; GO:0060456 positive regulation of digestive system process; GO:0070093 negative regulation of glucagon secretion; GO:0071314 cellular response to cocaine; GO:0071549 c
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0043025 neuronal cell body; GO:0043196 varicosity; GO:0043204 perikaryon; GO:0045202 synapse

Sequence Information

  • Sequence:  SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII
  • Length:  41(145-185)
  • Propeptide:  MRLRLLVSAGMLLVALSSCLPCRALLSRGSVPRAPRAPQPLNFLQPEQPQQPQPVLIRMGEEYFLRLGNLNRSPAARLSPNSTPLTAGRGSRPSHDQAAANFFRVLLQQLQMPQRSLDSRAEPAERGAEDALGGHQGALERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK
  • Signal peptide:  MRLRLLVSAGMLLVALSSC
  • Modification:  T41 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulate the release of corticotropin from pituitary gland
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  Crhr2, Crhr1
  • Target Unid:  Q60748, P35347
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 1830 seconds ( PubMed ID: 1319455 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8CIT0-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004153_AF2.pdbhor004153_ESM.pdb

Physical Information

Mass: 547216 Formula: C208H343N59O64S2
Absent amino acids: CGWY Common amino acids: L
pI: 4.86 Basic residues: 6
Polar residues: 5 Hydrophobic residues: 16
Hydrophobicity: -25.61 Boman Index: -7708
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 111.95
Instability Index: 5246.83 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  1319455
  • Title:  NA